Contents
··Simple Explanation·Detailed Explanation
·More Simple Explanation·More Detailed Explanation·Kangxi Dictionary
Traditional Chinese:  (???? ???? ????)Pinyin: jiān, jiànHeader: 
 
Total Strokes: 10Extra Strokes: 5UTF-8: E7 9B 91
 
UTF-16: 76D1UTF-32: 000076D1GB 2312: 2864
 
Cangjie: LIBTFour Corner Code: 2810One word full code: jian1jianmin
 
One word double code: jijimiOne word single code: jjmCharacter structure: Top (left-right)-bottom
 
Level of decomposition: 5Strokes: 丨丨丿一丶丨????丨丨一Stroke sequence: 2231425221
 
Stroke Description: vertical, vertical, downwards-left, horizontal, downwards-right, vertical, turning, vertical, vertical, horizontalOthers' sequence: 2231425221
 
Structure of components: ((丨丨)(????(丿一)丶))皿(????(冂(丨????)丨丨)一)
 
Simple Explanation
军事监狱
  Supervisor (Supervisor) jiān Inspector: monitoring. Monitoring. Monitoring. Monitoring. Invigilator. Monitoring. Jail, prison: the prison. Custody. Imprisonment. Prison. Supervisor (Supervisor) jiàn ancient Guan Ming or official name: Eunuch (eunuch, lots of people). Imperial College. Astronomical (official in charge of astronomical calendar.) Supervisor Johnson (who was educated in the Imperial College, also donated money too.) Old with the "Kam", mirrors. Old with the "Kam", reference, reference. Name. Stroke: 10; radicals: dish; stroke order code: 2231425221
Detailed Explanation
  Prison
  Prison
  jiān
  【Activity】
  (Knowing. Oracle shape, eyes wide open in the left is a man to look down (Morrison, vertical head), the right is a vessel. Inscriptions and a small increase in the vessels of the cross, said the device in the water. Ancients with water as a mirror "prison" is a person bent over, eyes wide open, the water from the vessel to look after their own face,. the original meaning: monitoring, supervision and look)
  〗 〖Supervise with the original meaning
  Monitoring, even under the provisional. - "Said the text"
  Establish the monitoring. - "Zhou Tai Zai." Note: "a country that 公侯伯子男 the prison."
  He does not need supervision. - "Poetry Festival Xiaoya Nanshan"
  Monitoring, observing also. - "Second dialect"
  Shijianbangzhe. - "Singer of the song." Note: "police are."
  To monitor the up and down the likes. "
  Wu Shu is based on false king, prison west of Zhujiang hit Xing Yang. - "Historical Records Chenshe family"
  Wrath of the king, was Wu Wei, the supervisor who slander. - "Singer of the song on"
  Yimenjianzhe. - "Records of Wei Gongzi Biography"
  Fortitude cut prison. - Qing Liang "Tan Biography"
  Another example: Monitor Pro (top-down monitoring visits); Supervisor (Supervision editing); monitoring spy (view); monitoring solution (clear grasp, resolution)
  Charge; competent〗 〖takecharge. Such as: The Control Yuan (regulatory monastery monks); monitoring the primary (the primary clinical supervisor of officials keep; charge of the prison officials); supervisor (an enterprise or business organization to monitor the work as a leading member); monitoring Shuai (monitoring military affairs of the Lord )
  Ancient refers to the Prince or the veteran minister of state affairs of state on behalf of the palm〗 〖actfor. Such as: monitoring the country (monarch unable Chikamasa by Elegance on his behalf)
  Imprisonment; held〗 〖imprison. Such as: monitoring climate (imprisoned awaiting trial; or suspended sentence after a capital offense, shut up and wait for the autumn trial review); monitor recovery (imprisonment for up strictly deadline); monitoring system (also known as "prison terms." Detained, imprisoned)
  Command, led the command〗 〖
  Di will subsequently monitor the judges I work. - "The book Luo Patent"
  Another example: Supervisor Yu (command); monitoring system (monitoring system management)
  Prison
  Prison
  jiān
  【Name】
  〗 〖Prison prison
  Five-room supervisor. - Qing Fang Bao "Prison Diary"
  Prison board house.
  Another example: shop supervisor (temporary detention facility); recover recover (prison); prison regulations (the prison rules and regulations); supervisor ratio (prison pursued payment)
  Supervision, guidance or advice of people〗 〖proctor
  Large fits not ordered four county supervisors rank Chu. - "The Book of Rites that." Note: "Mt Lin Chuanze the officer."
  Another example: The Superintendent (Qing Dynasty _set_ up in the middle school above school official)
  〗 〖Dukesorprincesunderanemperor that Uncooperative
  Code is applied in the nations, and built their animal husbandry and establish its supervision. - "Zhou Tai Zai"
  See jiàn
  Monitoring
  jiāncè
  〗 〖Monitor regulatory and inspection
  Air pollution monitoring
  Monitoring
  jiānchá
  〖Supervise; control〗 supervision visits; monitoring report
  Supervision
  jiāndū
  〖Supervise; preside; overlook; oversee; police; superintend; watch〗: View and manage
  Supervision of work
  〗 〖Supervisor: people who work in supervision
  Supervisor
  jiāngōng
  〖Overseer; supervisor; taskmaster; steward; sporter; foreman〗: Responsible for the timely completion of the work of a team of workers and supervisors
  〖Supervisework; oversee〗: in factories, mines, site supervision and workers to work
  Regulation
  jiānguǎn
  〖Watchandcontrol; takechargeof〗 custody of offenders to monitor
  Guardianship
  jiānhù
  〖Tutelage; guardianship〗: For minors, the mentally ill and other persons, property and other legitimate rights and interests of the supervision and protection
  〗 〖Control: Inspector
  〖Supervise; intensivecare〗: close observation of critically ill patients for timely rescue
  Guardian
  jiānhùrén
  〖Tutor; curator; guardian〗 who bear the responsibility of guardianship
  Imprisonment
  jiānjìn
  〖Shut; enclose; detain; imprison; incarcerate; beunderlockandkey; putinjail; takeintocustody; throwintoprison〗 man held up, restriction of personal freedom
  His imprisonment in a small room
  Invigilate
  jiānkǎo
  〖Invigilate; monitorstudentsduringawrittenexamination〗: watch the candidates, so as not to corrupt
  〗 〖Invigilator: examiner who
  Monitoring
  jiānkòng
  〗 〖Monitorandcontrol monitoring and control
  Monitoring System
  Prison
  jiānláo
  〖Cage; prison〗 cell; prison
  Prison doors
  jiānmén
  〗 〖Gatekeeper gatekeeper
  Keep the doors of the service. - "Han Feizi"
  The doors of the support.
  Not to storm the doors. - "Records of Wei Gongzi Biography"
  Monitoring, animal husbandry,
  jiānmù
  〗 〖Prefectapostolic the supervision of the Apostles heads of district
  Scrutinize balloting
  jiānpiào
  Vote Monitor〗 〖scrutinizeballoting
  Monitoring
  jiānshì
  〖Monitor; watch; spy; beonconstantguard〗: monitoring the sidelines watching
  Monitor all of our heavy bomber, the radar station
  〖Supervise; keeptabson〗: Supervision
  Monitor
  jiāntīng
  〖Monitor; listenin〗 use of special equipment to monitor other people's conversation or other communication signals sent
  Monitor the wireless telephone from Hawaii to issue a call
  Monitor the enemy's communication lines
  Custody
  jiānyā
  〗 〖Jail custody; detained
  Prison
  jiānyù
  〖Prison; jail; cage; cala-boose; cell; gaol; glass-house; lock-up; roguehouse; brig; chocky; cooler; coop; jug; guod〗 buildings to prison inmates
  Supervisor Weaving
  jiānzhīzào
  〗 〖TitleofofficerwieldedimperialfamilysilkknitgoodsinMingdynasty Ming Dynasty in Nanjing, Suzhou, Hangzhou, prefect of the home of a man weaving eunuchs in charge of royal silk used
  Weaving by the human supervisor. - Qing Zhang Tingyu "Ming Dynasty"
  Producer
  jiānzhì
  〖Supervi_set_hemanufactureofunderagreementwith; underauthoitywith〗 supervise the product manufacturing
  Prison
  Prison
  jiàn
  【Activity】
  Links "Kam"
  Reference 〖useforreference; drawlessonsfrom〗
  I can not have summer without supervisor, supervisor may not have Yin. - "The book called Patent"
  Quartet monitoring view, find the people of Mozambique. - "Poetry Taiga Wong carry on"
  Xia Jie Cheng Tang supervisor, so the main rule the heart and slow. - "Zi Covering"
  According to reflect〗 〖
  No one in the water prison, when the people monitoring. - "Book wine Patent"
  Drop out of God, monitoring his virtue. - "Zuo Zhuang three years"
  Xi You still's, a girl black and very beautiful, light can monitor people. - "Jin Yang Shu Ji Biography of Women"
  See jiān
  Monitoring of the
  jiànběn
  〗 〖BooksoftheImperialCollege the engraving of each dynasty's Imperial College book
  Health monitor
  jiànshēng
  〖StudentoftheImperialCollege; studentoftheImperialcollegeinfeudalChina〗 Ming and Qing dynasties, said progress made in the Imperial College Imperial College to study or read a competent person
More Simple Explanation
  Supervisor (knowing. Oracle shape, eyes wide open in the left is a man to look down (Morrison, vertical head), the right is a vessel. Inscriptions and a small increase in the vessels of the cross, that device in the water. Ancients to water Mirror, monitoring "is a person bent over, eyes wide open, the water from the vessel to look after their own face,. the original meaning of supervision, to see urge) with the original meaning of Da, even under the Pro. -" said the text "_set_ the prison. - "Zhou Tai Zai." Note that the 公侯伯子男 one country of the prison. "He does not need supervision. - "Poetry Festival Xiaoya Nanshan," monitoring, observing also. - "Second dialect" to monitor those who slander. - "Singer of the song." Note also the police. "To monitor the upper and lower appeal to their preferences." Wu Shu is based on false king, prison west of Zhujiang hit Xing Yang. - "Historical Records Chenshe family" wrath of the king, Supervisor (Da) jiān ⒈ look, and inspectors, from the point of view under the ~ Governor. ~ Police. ~ View of the Quartet. ⒉ prison, prison ~ prison. ~ Prison. Sit ~ room. ⒊ ⒋ Supervisor (Da) jiàn ⒈ Guan Ming era of King County home or keep the official signature, Wei, ~. State child ~. Chin-day ~ (in charge of astronomy, the official calendar, etc.). ⒉ mirror, draw (draw) out ~. ~ In the Xia Jie Cheng Tang. Supervisor kàn 1. Names with words. See "prison town."
More Detailed Explanation
  Supervisor jian
  Radical Radical pan 05 total strokes 10 strokes
  Prison
  inspect; prison; supervise; watch;
  Supervisor 1
  (1)
  Da
  jiān
  (2)
  (Knowing. Oracle shape, eyes wide open in the left is a man to look down (Morrison, vertical head), the right is a vessel. Inscriptions and a small increase in the vessels of the cross, said the device in the water. Ancients with water as a mirror , prison "is a person bent over, eyes wide open, the water from the vessel to look after their own face,. the original meaning of supervision, to see urge)
  (3)
  With the original meaning of [supervise]
  Da, even under the provisional. - "Said the text"
  Establish the monitoring. - "Zhou Tai Zai." Note that the 公侯伯子男 the prison of a country. "
  He does not need supervision. - "Poetry Festival Xiaoya Nanshan"
  Monitoring, observing also. - "Second dialect"
  Shijianbangzhe. - "Singer of the song." Note also the police. "
  To monitor the up and down the likes. "
  Wu Shu is based on false king, prison west of Zhujiang hit Xing Yang. - "Historical Records Chenshe family"
  Wrath of the king, was Wu Wei, the supervisor who slander. - "Singer of the song on"
  Yimenjianzhe. - "Records of Wei Gongzi Biography"
  Fortitude cut prison. - Qing Liang "Tan Biography"
  (4)
  Another example is the clinical supervisor (supervision and inspection from top to bottom); Supervisor (Supervision editing); monitoring spy (view); monitoring solution (clear grasp, resolution)
  (5)
  Charge; charge [take charge]. Such as the Control Yuan (regulatory monastery monks); monitoring the primary (the primary clinical supervisor of officials keep; charge of the prison officials); supervisor (an enterprise or business organization to monitor the work as a leading member); monitoring Shuai (monitoring military affairs of the Lord)
  (6)
  Ancient refers to the Prince or the veteran affairs of state minister of state on behalf of the palm [act for]. Such as monitoring the country (monarch unable Chikamasa by Elegance on his behalf)
  (7)
  Imprisonment; held [imprison]. Such as monitoring climate (imprisoned awaiting trial; or suspended sentence after a capital offense, shut up and wait for the autumn trial review); monitor recovery (imprisonment for up strictly deadline); monitoring system (also known as prison terms. "Detained, imprisoned)
  (8)
  Command, led by [command]
  Di will subsequently monitor the judges I work. - "The book Luo Patent"
  (9)
  Another example is monitoring Yu (command); monitoring system (monitoring system management)
  Prison
  (1)
  Da
  jiān
  (2)
  Prison [prison]
  Five-room supervisor. - Qing Fang Bao "Prison Diary"
  Prison board house.
  (3)
  Another example is the shop supervisor (temporary detention facility); recover recover (prison); prison regulations (the prison rules and regulations); supervisor ratio (prison pursued payment)
  (4)
  Supervision, guidance or advice of people [proctor]
  Large fits not ordered four county supervisors rank Chu. - "The Book of Rites that." Shan Lin Chuanze note of the officer. "
  (5)
  Another example is the superintendent (Qing Dynasty _set_ up in the middle school above school official)
  (6)
  Means Uncooperative [dukes or princes under an emperor]
  Code is applied in the nations, and built their animal husbandry and establish its supervision. - "Zhou Tai Zai"
  See jiàn
  Monitoring
  jiāncè
  [Monitor] monitor and detect
  Air pollution monitoring
  Monitoring
  jiānchá
  [Supervise; control] monitoring visits; monitoring report
  Supervision
  jiāndū
  (1)
  [Supervise; preside; overlook; oversee; police; superintend; watch]: View and manage
  Supervision of work
  (2)
  [Supervisor]: people who work in supervision
  Supervisor
  jiāngōng
  (1)
  [Overseer; supervisor; taskmaster; steward; sporter; foreman]: a team of workers responsible for the timely completion of the work of the supervisor
  (2)
  [Supervise work; oversee]: in factories, mines, site supervision and workers to work
  Regulation
  jiānguǎn
  [Watch and control; take charge of] monitoring care of criminals
  Guardianship
  jiānhù
  (1)
  [Tutelage; guardianship]: to the minors, the mentally ill and other persons, property and other legitimate rights and interests of the supervision and protection
  (2)
  [Control]: Inspector
  (3)
  [Supervise; intensive care]: close observation of critically ill patients for timely rescue
  Guardian
  jiānhùrén
  [Tutor; curator; guardian] who bears the responsibility of guardianship
  Imprisonment
  jiānjìn
  [Shut; enclose; detain; imprison; incarcerate; be under lock and key; put in jail; take into custody; throw into prison] the people locked up, restriction of personal freedom
  His imprisonment in a small room
  Invigilate
  jiānkǎo
  (1)
  [Invigilate; monitor students during a written examination]: watch the candidates, so as not to corrupt
  (2)
  [Invigilator]: examiner who
  Monitoring
  jiānkòng
  [Monitor and control] to monitor and control
  Monitoring System
  Prison
  jiānláo
  [Cage; prison] cells; prison
  Prison doors
  jiānmén
  [Gatekeeper] Gatekeeper
  Keep the doors of the service. - "Han Feizi"
  The doors of the support.
  Not to storm the doors. - "Records of Wei Gongzi Biography"
  Monitoring, animal husbandry,
  jiānmù
  [Prefect apostolic] apostolic oversight of heads of district
  Scrutinize balloting
  jiānpiào
  [Scrutinize balloting] monitor voting
  Monitoring
  jiānshì
  (1)
  [Monitor; watch; spy; be on constant guard]: monitoring the sidelines watching
  Monitor all of our heavy bomber, the radar station
  (2)
  [Supervise; keep tabs on]: Supervision
  Monitor
  jiāntīng
  [Monitor; listen in] the use of special equipment to monitor other people's conversation or other communication signals sent
  Monitor the wireless telephone from Hawaii to issue a call
  Monitor the enemy's communication lines
  Custody
  jiānyā
  [Jail] in custody; detention
  Prison
  jiānyù
  [Prison; jail; cage; cala-boose; cell; gaol; glass-house; lock-up; rogue house; brig; chocky; cooler; coop; jug; guod] for the imprisonment of prisoners of buildings
  Supervisor Weaving
  jiānzhīzào
  [Title of officer wielded imperial family silk knit goods in ming dynasty] Ming Dynasty in Nanjing, Suzhou, Hangzhou, prefect of the home of a man weaving eunuchs in charge of royal silk used
  Weaving by the human supervisor. - Qing Zhang Tingyu "Ming Dynasty"
  Producer
  jiānzhì
  [Supervise the manufacture of under agreement with; under authoity with] supervise the product manufacturing
  Supervisor 2
  (1)
  Da
  jiàn
  (2)
  Chronicle "
  (3)
  Reference [use for reference; draw lessons from]
  I can not have summer without supervisor, supervisor may not have Yin. - "The book called Patent"
  Quartet monitoring view, find the people of Mozambique. - "Poetry Taiga Wong carry on"
  Xia Jie Cheng Tang supervisor, so the main rule the heart and slow. - "Zi Covering"
  (4)
  According to [reflect]
  No one in the water prison, when the people monitoring. - "Book wine Patent"
  Drop out of God, monitoring his virtue. - "Zuo Zhuang three years"
  Xi You still's, a girl black and very beautiful, light can monitor people. - "Jin Yang Shu Ji Biography of Women"
  See jiān
  Monitoring of the
  jiànběn
  [Books of the imperial college] Marking the various dynasties of Imperial College by the book
  Health monitor
  jiànshēng
  [Student of the imperial college; student of the imperial college in feudal china] Ming and Qing dynasties, said progress made in the Imperial College Imperial College to study or read a competent person
  Supervisor 1
  (Da)
  jiān ㄐ ㄧ ㄢ ˉ
  (1)
  ~ Police inspector. ~ Control. ~ Test. ~ Care. ~ Test. ~ Listen.
  (2)
  Jail, prison ~ prison. ~ Charge. ~ Ban. Sit ~.
  Zheng code kdml, u76d1, gbkbce0
  Number of 10 strokes, radical pan, Stroke No. 2231425221
  inspect; prison; supervise; watch;
  Supervisor 2
  (Da)
  jiàn ㄐ ㄧ ㄢ ╝
  (1)
  Guan Ming or the official name of the ancient too ~ (eunuchs, lots of people). State child ~. Chin-day ~ (official in charge of astronomical calendar.) ~ Students (who was educated at Imperial College, also donated money too.)
  (2)
  Old with Kam, "mirror.
  (3)
  Old with Kam, "reference, reference.
  (4)
  Name.
  Zheng code kdml, u76d1, gbkbce0
  Number of 10 strokes, radical pan, Stroke No. 2231425221
Kangxi Dictionary
Afternoon focus  Ancient 〔〕 【???? ???? Jian Yun Tang Yun】 【is the ancient title cut 【】】 【Ji Yun Yun will】 ranking title cut, ???? reduced level tone. 【】 Pro that even under the text. Xu said】 【homes to temporary, the monitoring of the well. Yangtze dialect】 【police also. Guangyun】 【collar too. Xiaoya】 【poetry does not need any supervision. What memo】 【used as a post woman, do not monitor it. 】 【Ceremony of King Emperor to the doctor for the three supervisors. Supervisor of the deputy of the country. 【Note】 make Junior the deputy, leading princes, the inspectors of the provisional supervisor also. Falling tone on the monitor, under the supervision level tone. 【Big slaughtered Zhou days the post of official State of its state prison】. 【Note】 that 公侯伯子男, the supervisor of a country. Posts】 【Zhuang Tian-yun soil under clinical supervision, the world is wearing it, what we called Shang Huang. House】 【rhyme and photo also. Min two years】 【Zuo Jun-line is to defend, keep monitoring the country said. And a small complement】 【rhyme will view as well. 【Language】 long prison Lu world. And monitor sleep soundly, Utah http sleep soundly too. After】 【Ji Han Huan Mei http monitor sigh. 【Note】 Although sleep and insomnia are also made. Pro Day is also another cloud. Official】 【Zhou Chun-hui Shi Fa ten evil force palm, Si Yue prison. 】 【Sparse clouds in the day that there is next to red, such as crown Joel. Joel, calipering ear also. And star names. Historical Records official books】 【Yin in the Yin-year-old, Jupiter, as a home ugly morning the first month the East German Dubbed prison. Tang Yun and 【】 【cell Repentance cut will _set_ rhyme rhyme】 【】 【Home Repentance cut cut Rhymes An old _set_tlement, ???? minus the sound. Meaning the same. Also】 【Tongxun as well. Col Taijia】 days monitoring Jue Germany, with the _set_ of Da Ming. Daya】 【Poetry Quartet monitoring view, find the people of Mozambique. And Guan Ming. Records of the Yellow Emperor Wudi Ji】 【_set_ about monitoring. Another hundred Shangguan】 【Tang Temple officials said other Temple, said prison. And rhyme will】 【Court and the Salt and Iron, animal husbandry, the government Jieyue prison officials. Huan Yi Yue Temple and monitoring. Qin Ji】 【Records by Jing Jian Yang of Wei asked to see the duke. 【Note】 prison, suddenly people. Another name. 【】 Wei Kang Shu Su Tung is the supervisor for the even, then s Yan. 【Home】 Records Tianqi Shi Qi ???? monitoring only for the public phase. 【Note】 prison, one for the Kan. They will】 【rhyme for Kam Tong Jian. Patent】 【were no books on wine, water monitoring, when the people monitoring. 【Class】 Jie Fu-Yu ???? self-injury in order to mirror monitor Ladies. And supervisor monitoring, supervision, such as gold and see the truth behind also. Yang Ming by】 【Lingshu contingent on prison monitoring. 】 【Ji Yun and indiscriminate cutting hard, sound Kan. Names, in the East Gapyeong-gun. Records Sealing a book】 【Chi township supervisor in Dongping Lu, Qi Xi Jing also. 【Note】 monitoring, audio Kan. Poetry and Remonstrance】 【ago Hanwei Meng Wang how I had not Sri Lanka perusal. Yellow hair is not close to Hu from time to time monitor. Monitoring leaf sheets, browse audio abuse. And leaves too old cut, audio Jian. Han Yu Chung】 【middle child in the weeks Xing, pension beg statement. Its been bad, abusive person to prison. Six are E】 【Pro province from the sound, and meaning. Those from the blood, and ???? synonymous. In ancient drink blood for ????, books in their statements, saying: that God monitor it. Therefore ???? and supervision are from the blood, agree. Research: 〔】 【Zuo Jun Min two years, there defensive line, keep monitoring the country said. 〕 Like the word according to the original province. Official book 〔】 【Historical Records in the Yin-year-old Yin, Jupiter, as a home ugly, Chen out of the first month the East German Dubbed the prison. According to the original e〕 would like to change out of a morning.

Comments (0)